General Information

  • ID:  hor004562
  • Uniprot ID:  P0DM27
  • Protein name:  Conorfamide-Tx2
  • Gene name:  NA
  • Organism:  Conus textile (Cloth-of-gold cone)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  Expressed by the venom duct.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cylinder (subgenus), Conus (genus), Conidae (family), Conoidea (superfamily), Neogastropoda (order), Caenogastropoda (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0090729 toxin activity
  • GO BP:  GO:0035821 modulation of process of another organism
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HSGILLAWSGPRNRFVRI
  • Length:  18(26-43)
  • Propeptide:  MSGRGFLLLALLLLVTVEATRVEKKHSGILLAWSGPRNRFVRIGRRDMQSPLLSERLRFRALGFRQPSSQKQ
  • Signal peptide:  MSGRGFLLLALLLLVTVEA
  • Modification:  T18 Isoleucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Induces scratching
  • Mechanism:  The mature peptide does not contain cysteine residue.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P0DM27-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004562_AF2.pdbhor004562_ESM.pdb

Physical Information

Mass: 238284 Formula: C95H151N31O22
Absent amino acids: CDEKMQTY Common amino acids: R
pI: 12.8 Basic residues: 4
Polar residues: 5 Hydrophobic residues: 8
Hydrophobicity: 1.67 Boman Index: -3014
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 108.33
Instability Index: 1809.44 Extinction Coefficient cystines: 5500
Absorbance 280nm: 323.53

Literature

  • PubMed ID:  30243794
  • Title:  Conopeptides promote itch through human itch receptor hMgprX1.